Hemokinin 1 (mouse, rat) trifluoroacetate salt
Product Name :
Hemokinin 1 (mouse, rat) trifluoroacetate salt
Synonym :
H-Arg-Ser-Arg-Thr-Arg-Gln-Phe-Tyr-Gly-Leu-Met-NH2 H-RSRTRQFYGLM-NH2
Chemical Name :
CAS NO.:
208041-90-1
Molecular formula :
C61H100N22O15S
Molecular Weight:
1,413.65 g/mol
Classification :
MedChemExpress Products > Research Chemicals > Hemokinin 1 (mouse, rat) trifluoroacetate salt
Description:
Hemokinin 1 is a protein that is encoded by the NK1R gene. It has been shown to be associated with insulin resistance, inflammatory diseases, and pain control. Hemokinin 1 is also a potential treatment for viral infections such as HIV and hepatitis C. Hemokinin 1 interacts with nicotinic acetylcholine receptors (nAChRs) in the brain and blood vessels, which leads to an increase in blood pressure. This protein also interacts with hematopoietic cells, which may be responsible for its function as an antinociceptive agent. Hemokinin 1 has been implicated in autoimmune diseases such as arthritis and atrial fibrillation. This protein is expressed mainly in the brain, liver, heart, kidneys and spleen.
Purity :
>98%
Specifications :
1 mg
Price.:
70
Price unit :
$
Inventory :
In stock
Related websites: https://www.medchemexpress.com
119413-54-6 medchemexpress 1201438-56-3 Synonym PMID:30085565 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Adipocyte plasma membrane-associated protein
Product Name :
Adipocyte plasma membrane-associated protein
Brief Description :
Recombinant Protein
Accession No. :
Q9HDC9Gene name:APMAP
Calculated MW :
39.05
Target Sequence :
Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q9HDC9
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
TMEM43 Antibody custom synthesis SCARB1 Antibody manufacturer PMID:35081858 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
RP-54745
Product Name :
RP-54745
Synonym :
Chemical Name :
CAS NO.:
135330-08-4
Molecular formula :
C13H12ClNOS2
Molecular Weight:
297.82 g/mol
Classification :
MedChemExpress Products > Life Sciences > RP-54745
Description:
RP-54745 is a synthetic product that inhibits oxidative phosphorylation by inhibiting mitochondrial ATPase. This inhibitor has been shown to be effective in the treatment of inflammatory bowel disease, mental disorders and bowel disease. RP-54745 has also been shown to inhibit the synthesis of inflammatory cytokines such as TNF-α and IL-6. It is thought that this inhibition may be due to the inhibition of the activity of cyclooxygenase and lipoxygenase. RP-54745 also inhibits scleral blood vessels, which may be used for treatment of eye diseases such as retinal tissue inflammation.
Purity :
>98%
Specifications :
10 mM * 1 mL
Price.:
393
Price unit :
$
Inventory :
In stock
Related websites: https://www.medchemexpress.com
25322-68-3 web 51333-22-3 custom synthesis PMID:29630241 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Galactoside-binding soluble lectin 13
Product Name :
Galactoside-binding soluble lectin 13
Brief Description :
Recombinant Protein
Accession No. :
Q9UHV8Gene name:LGALS13
Calculated MW :
14.63
Target Sequence :
Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
Q9UHV8
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
p-Bromophenoxyaceticacid Technical Information N-Benzoylimidazole supplier PMID:34962085 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Copanlisib
Product Name :
Copanlisib
Synonym :
2-Amino-N-(7-methoxy-8-(3-morpholinopropoxy)-2,3-dihydroimidazo[1,2-c]quinazolin-5-yl)pyrimidine-5-carboxamideBAY 80-6946
Chemical Name :
CAS NO.:
1032568-63-0
Molecular formula :
C23H28N8O4
Molecular Weight:
480.52 g/mol
Classification :
MedChemExpress Products > Life Sciences > Ligands > Enzyme Modulators > Copanlisib
Description:
Class 1 PI3K enzyme inhibitor; anti-neoplastic
Purity :
>98%
Specifications :
5 mg
Price.:
60
Price unit :
$
Inventory :
In stock
Related websites: https://www.medchemexpress.com
162359-55-9 custom synthesis 65277-42-1 Formula PMID:30335516 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
UMP-CMP kinase
Product Name :
UMP-CMP kinase
Brief Description :
Recombinant Protein
Accession No. :
P30085Gene name:CMPK1
Calculated MW :
19.8
Target Sequence :
Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
P30085
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Sirukumab Purity MAPK7 Antibody In Vitro PMID:35219224 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Nimustine HCl
Product Name :
Nimustine HCl
Synonym :
Chemical Name :
CAS NO.:
55661-38-6
Molecular formula :
C9H13ClN6O2·HCl
Molecular Weight:
309.15 g/mol
Classification :
MedChemExpress Products > Research Chemicals > Nimustine HCl
Description:
DNA crosslinking agent
Purity :
>98%
Specifications :
10 mM * 1 mL
Price.:
61
Price unit :
$
Inventory :
In stock
Related websites: https://www.medchemexpress.com
9001-73-4 custom synthesis 247062-33-5 Molecular Weight PMID:30000539 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Recombinant Human B7-H2,ICOSLG,CD275 (C-6His)
Product Name :
Recombinant Human B7-H2,ICOSLG,CD275 (C-6His)
Brief Description :
Accession No. :
O75144
Calculated MW :
27.72kDa
Target Sequence :
DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSVDHHHHHH
Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.
Application Details :
Uniprot :
O75144
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Phospho-CDC6 Antibody custom synthesis EphA8 Antibody In Vitro PMID:35161387 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
Serine/arginine-rich splicing factor 3
Product Name :
Serine/arginine-rich splicing factor 3
Brief Description :
Recombinant Protein
Accession No. :
P84103Gene name:SRSF3
Calculated MW :
Target Sequence :
Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
Application Details :
Uniprot :
P84103
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Cyclin B1 Antibody Epigenetics Keap1 Antibody custom synthesis PMID:34860319 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com
5-Chloro-2-mercaptobenzimidazole
Product Name :
5-Chloro-2-mercaptobenzimidazole
Synonym :
Chemical Name :
CAS NO.:
25369-78-2
Molecular formula :
C7H5ClN2S
Molecular Weight:
184.65 g/mol
Classification :
MedChemExpress Products > Research Chemicals > Building Blocks > Nitrogen Heterocycles > 5-Chloro-2-mercaptobenzimidazole
Description:
5-Chloro-2-mercaptobenzimidazole is an inorganic base that is used as a microscopy reagent. It has been shown to have a transfer mechanism that is similar to the hydrogen ion transfer mechanism. 5-Chloro-2-mercaptobenzimidazole has been used in vivo assays and has functional groups that are important for its use in coatings and aluminum oxide. The molecule also contains chlorine atoms, which are important for its use in chlorination reactions. 5-Chloro-2-mercaptobenzimidazole can be used in voltammetry to test samples of organic compounds (e.g., casein) and has been shown to be effective against the Gram positive bacterium Staphylococcus aureus.
Purity :
>98%
Specifications :
1 g
Price.:
30
Price unit :
$
Inventory :
In stock
Related websites: https://www.medchemexpress.com
68181-17-9 Synonym 12112-67-3 manufacturer PMID:29261966 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com