Hemokinin 1 (mouse, rat) trifluoroacetate salt

Product Name :
Hemokinin 1 (mouse, rat) trifluoroacetate salt

Synonym :
H-Arg-Ser-Arg-Thr-Arg-Gln-Phe-Tyr-Gly-Leu-Met-NH2 H-RSRTRQFYGLM-NH2

Chemical Name :

CAS NO.:
208041-90-1

Molecular formula :
C61H100N22O15S

Molecular Weight:
1,413.65 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Hemokinin 1 (mouse, rat) trifluoroacetate salt

Description:
Hemokinin 1 is a protein that is encoded by the NK1R gene. It has been shown to be associated with insulin resistance, inflammatory diseases, and pain control. Hemokinin 1 is also a potential treatment for viral infections such as HIV and hepatitis C. Hemokinin 1 interacts with nicotinic acetylcholine receptors (nAChRs) in the brain and blood vessels, which leads to an increase in blood pressure. This protein also interacts with hematopoietic cells, which may be responsible for its function as an antinociceptive agent. Hemokinin 1 has been implicated in autoimmune diseases such as arthritis and atrial fibrillation. This protein is expressed mainly in the brain, liver, heart, kidneys and spleen.

Purity :
>98%

Specifications :
1 mg

Price.:
70

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
119413-54-6 medchemexpress 1201438-56-3 Synonym PMID:30085565 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Adipocyte plasma membrane-associated protein

Product Name :
Adipocyte plasma membrane-associated protein

Brief Description :
Recombinant Protein

Accession No. :
Q9HDC9Gene name:APMAP

Calculated MW :
39.05

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
Q9HDC9

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
TMEM43 Antibody custom synthesis SCARB1 Antibody manufacturer PMID:35081858 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

RP-54745

Product Name :
RP-54745

Synonym :

Chemical Name :

CAS NO.:
135330-08-4

Molecular formula :
C13H12ClNOS2

Molecular Weight:
297.82 g/mol

Classification :
MedChemExpress Products > Life Sciences > RP-54745

Description:
RP-54745 is a synthetic product that inhibits oxidative phosphorylation by inhibiting mitochondrial ATPase. This inhibitor has been shown to be effective in the treatment of inflammatory bowel disease, mental disorders and bowel disease. RP-54745 has also been shown to inhibit the synthesis of inflammatory cytokines such as TNF-α and IL-6. It is thought that this inhibition may be due to the inhibition of the activity of cyclooxygenase and lipoxygenase. RP-54745 also inhibits scleral blood vessels, which may be used for treatment of eye diseases such as retinal tissue inflammation.

Purity :
>98%

Specifications :
10 mM * 1 mL

Price.:
393

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
25322-68-3 web 51333-22-3 custom synthesis PMID:29630241 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Galactoside-binding soluble lectin 13

Product Name :
Galactoside-binding soluble lectin 13

Brief Description :
Recombinant Protein

Accession No. :
Q9UHV8Gene name:LGALS13

Calculated MW :
14.63

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
Q9UHV8

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
p-Bromophenoxyaceticacid Technical Information N-Benzoylimidazole supplier PMID:34962085 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Copanlisib

Product Name :
Copanlisib

Synonym :
2-Amino-N-(7-methoxy-8-(3-morpholinopropoxy)-2,3-dihydroimidazo[1,2-c]quinazolin-5-yl)pyrimidine-5-carboxamideBAY 80-6946

Chemical Name :

CAS NO.:
1032568-63-0

Molecular formula :
C23H28N8O4

Molecular Weight:
480.52 g/mol

Classification :
MedChemExpress Products > Life Sciences > Ligands > Enzyme Modulators > Copanlisib

Description:
Class 1 PI3K enzyme inhibitor; anti-neoplastic

Purity :
>98%

Specifications :
5 mg

Price.:
60

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
162359-55-9 custom synthesis 65277-42-1 Formula PMID:30335516 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

UMP-CMP kinase

Product Name :
UMP-CMP kinase

Brief Description :
Recombinant Protein

Accession No. :
P30085Gene name:CMPK1

Calculated MW :
19.8

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P30085

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Sirukumab Purity MAPK7 Antibody In Vitro PMID:35219224 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Nimustine HCl

Product Name :
Nimustine HCl

Synonym :

Chemical Name :

CAS NO.:
55661-38-6

Molecular formula :
C9H13ClN6O2·HCl

Molecular Weight:
309.15 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Nimustine HCl

Description:
DNA crosslinking agent

Purity :
>98%

Specifications :
10 mM * 1 mL

Price.:
61

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
9001-73-4 custom synthesis 247062-33-5 Molecular Weight PMID:30000539 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Human B7-H2,ICOSLG,CD275 (C-6His)

Product Name :
Recombinant Human B7-H2,ICOSLG,CD275 (C-6His)

Brief Description :

Accession No. :
O75144

Calculated MW :
27.72kDa

Target Sequence :
DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSVDHHHHHH

Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.

Application Details :

Uniprot :
O75144

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Phospho-CDC6 Antibody custom synthesis EphA8 Antibody In Vitro PMID:35161387 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Serine/arginine-rich splicing factor 3

Product Name :
Serine/arginine-rich splicing factor 3

Brief Description :
Recombinant Protein

Accession No. :
P84103Gene name:SRSF3

Calculated MW :

Target Sequence :

Storage :
Store at -20C. (Avoid repeated freezing and thawing.)Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Application Details :

Uniprot :
P84103

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Cyclin B1 Antibody Epigenetics Keap1 Antibody custom synthesis PMID:34860319 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

5-Chloro-2-mercaptobenzimidazole

Product Name :
5-Chloro-2-mercaptobenzimidazole

Synonym :

Chemical Name :

CAS NO.:
25369-78-2

Molecular formula :
C7H5ClN2S

Molecular Weight:
184.65 g/mol

Classification :
MedChemExpress Products > Research Chemicals > Building Blocks > Nitrogen Heterocycles > 5-Chloro-2-mercaptobenzimidazole

Description:
5-Chloro-2-mercaptobenzimidazole is an inorganic base that is used as a microscopy reagent. It has been shown to have a transfer mechanism that is similar to the hydrogen ion transfer mechanism. 5-Chloro-2-mercaptobenzimidazole has been used in vivo assays and has functional groups that are important for its use in coatings and aluminum oxide. The molecule also contains chlorine atoms, which are important for its use in chlorination reactions. 5-Chloro-2-mercaptobenzimidazole can be used in voltammetry to test samples of organic compounds (e.g., casein) and has been shown to be effective against the Gram positive bacterium Staphylococcus aureus.

Purity :
>98%

Specifications :
1 g

Price.:
30

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
68181-17-9 Synonym 12112-67-3 manufacturer PMID:29261966 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com