Name :
BMP5 (Human) Recombinant Protein
Biological Activity :
Human BMP5 (P22003, 317 a.a. – 454 a.a.) partial-length recombinant protein expressed in Escherichia coli.
Tag :
Protein Accession No. :
P22003
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=653
Amino Acid Sequence :
MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH.
Molecular Weight :
15.7
Storage and Stability :
Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
The BMP-5 solution contains 10mM Sodium Citrate buffer (pH3.5) and 10% Glycerol.
Applications :
SDS-PAGE，
Gene Name :
BMP5
Gene Alias :
MGC34244
Gene Description :
bone morphogenetic protein 5
Gene Summary :
This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. [provided by RefSeq
Other Designations :
OTTHUMP00000016650
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SCF ProteinSynonyms
Cathepsin D ProteinSynonyms
Popular categories:
Persephin
Serpin A9