Name :
CLC (Human) Recombinant Protein
Biological Activity :
Human CLC (NP_001819, 1 a.a. – 142 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
NP_001819
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=1178
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Molecular Weight :
18.6
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies AntIgEn Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Conventional Chromatography
Quality Control Testing :
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer :
In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Applications :
SDS-PAGE，
Gene Name :
CLC
Gene Alias :
LGALS10, LPPL_HUMAN, MGC149659
Gene Description :
Charcot-Leyden crystal protein
Gene Summary :
Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. [provided by RefSeq
Other Designations :
Charot-Leyden crystal protein|eosinophil lysophospholipase|galactin-10|galectin 10|lysolecithin acylhydrolase
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FSH MedChemExpress
EGF Proteincustom synthesis
Popular categories:
FGF-11
CD85f/LILRA5